PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe6G111300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family HD-ZIP
Protein Properties Length: 205aa    MW: 23764.6 Da    PI: 8.741
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe6G111300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox598e-1951103456
                        -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                        ++++++ q++ Le++F  ++++ ++++e++A++lgL+ +qV +WFqNrR +++
  Aqcoe6G111300.1.p  51 KRKLSAAQVNGLETYFSIDHNLETQRKERIASELGLDPQQVAIWFQNRRVRWR 103
                        458999**********************************************9 PP

2HD-ZIP_I/II103.91.3e-3350141293
        HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                        +kr+ls+ qv+ LE+ F+ +++Le++rK+++a+eLgl+p+qva+WFqnrR R++ k+lE +y +Lk++++++  e+++Le++v +L+++l++
  Aqcoe6G111300.1.p  50 RKRKLSAAQVNGLETYFSIDHNLETQRKERIASELGLDPQQVAIWFQNRRVRWRVKKLEDEYYKLKATHENVIVEKSQLESQVLRLKAQLSD 141
                        8***************************************************************************************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007115.82345105IPR001356Homeobox domain
SMARTSM003896.4E-1748109IPR001356Homeobox domain
CDDcd000863.80E-1450106No hitNo description
SuperFamilySSF466897.27E-1650111IPR009057Homeodomain-like
PfamPF000464.6E-1651103IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.609.3E-1856103IPR009057Homeodomain-like
PRINTSPR000314.0E-57685IPR000047Helix-turn-helix motif
PROSITE patternPS00027080103IPR017970Homeobox, conserved site
PRINTSPR000314.0E-585101IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 205 aa     Download sequence    Send to blast
MNQENAHLFF NIQDHTSSLY TYATSAEGET KKKKRQRRKK DKNEGGADAR KRKLSAAQVN  60
GLETYFSIDH NLETQRKERI ASELGLDPQQ VAIWFQNRRV RWRVKKLEDE YYKLKATHEN  120
VIVEKSQLES QVLRLKAQLS DAQNEMTRLV ERSDGVSSNS QSSSFSMDMD PFFLGDFGME  180
GLEKVFYFNN SVNGMEWVNN VYDM*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13136KKKRQR
23641RRKKDK
33752RKKDKNEGGADARKRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010999952.11e-61PREDICTED: homeobox-leucine zipper protein ATHB-40-like
TrEMBLA0A068U2N98e-62A0A068U2N9_COFCA; Uncharacterized protein
STRINGPOPTR_0007s12450.13e-60(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18550.15e-42homeobox protein 21